
+1 Recommend
0 collections
      • Record: found
      • Abstract: found
      • Article: not found

      Mst1 inhibits autophagy by promoting Beclin1-Bcl-2 interaction

      Read this article at

          There is no author summary for this article yet. Authors can add summaries to their articles on ScienceOpen to make them more accessible to a non-specialist audience.


          Here we show that Mammalian Ste20-like kinase 1 (Mst1), a pro-apoptotic kinase, negatively regulates protein quality control mechanisms through inhibition of autophagy in the heart. Stress-induced activation of Mst1 promotes accumulation of p62/SQSTM1 and aggresome formation, which are accompanied by the disappearance of autophagosomes in cardiomyocytes. Mst1 phosphorylates threonine 108 in the BH3 domain of Beclin1, which enhances interaction between Beclin1 and Bcl-2/Bcl-xL, stabilizes the Beclin1 homodimer, inhibits the PI3 kinase activity of the Atg14L-Beclin1-Vps34 complex, and suppresses autophagy. Furthermore, Mst1-induced sequestration of Bcl-2/Bcl-xL by Beclin1 allows Bax to become active, thereby stimulating apoptosis. Increased Mst1 activity is associated with cardiac dysfunction after myocardial infarction and dilated cardiomyopathy, due to inhibition of autophagy and aggresome accumulation. These results suggest that Mst1 coordinately regulates autophagy and apoptosis through phosphorylation of Beclin1 and consequent modulation of a three-way interaction between the Bcl-2 proteins, Beclin1 and Bax. Autophagy is a bulk degradation mechanism in which cytosolic proteins and organelles are sequestrated into autophagosomes and degraded by lysosomes 1 . Due to its large capacity, autophagy plays an essential role in maintaining organelle functions and protein quality by removing damaged organelles and protein aggregates. Suppression of autophagy below physiological levels through genetic deletion of Atg5 induces heart failure with enhanced protein aggregation, suggesting that autophagy is required to maintain baseline heart function 2 . Autophagy is upregulated in various pathological conditions, including myocardial ischemia, ischemia/reperfusion (I/R), and pressure overload 3–5 . Upregulation of autophagy during myocardial stress is generally compensatory, alleviating energy loss and scavenging damaged mitochondria and protein aggregates 3, 6 . On the other hand, deregulated activation of autophagy leads to excessive self-digestion and eventual cell death. I/R markedly upregulates Beclin1 and stimulates massive autophagy in the heart, and suppression of autophagy by downregulation of Beclin1 attenuates myocardial injury 4 . A possible explanation for the dichotomous function of autophagy in the heart is that autophagic activity either above or below the physiological range is detrimental 7, 8 . Currently, however, the signaling mechanism responsible for maintaining autophagic activity within the proper range is poorly understood. Beclin1, a Bcl-2-homology (BH)-3 domain-only protein 9 , plays an important role in both autophagosome formation and autolysosome fusion. Beclin1 and the class III-type phosphoinositide 3-kinase (Class III PI3K/Vps34) form two distinct complexes 10 . In complex I, which mediates autophagosome formation, Atg14L bridges between Beclin1 and the Vps34-p150 complex, whereas in complex II, which regulates the vacuolar protein sorting pathway, UVRAG bridges between Beclin1 and the Vps34-p150 complex 11 . The kinase activity of the Beclin1-Vps34 complex is negatively regulated by Bcl-2 family proteins 12 , which bind to Beclin1 and disrupt the interaction between Beclin1 and Vps34, thereby inhibiting autophagosome formation 7 . However, it remains unclear how Beclin1 and Bcl-2 family proteins associate with one another and induce formation of the inactive Beclin1 homodimer at baseline. Mammalian sterile 20-like kinase 1 (Mst1) is a serine threonine kinase and a component of the “Hippo” signaling pathway, which regulates apoptosis and organ size 13 . Mst1 is one of the protein kinases most strongly activated during cardiomyocyte apoptosis 14 , through either a Ras associated domain family 1 isoform A (Rassf1A)-dependent 15 or a caspase-dependent mechanism 14–16 . Persistent Mst1 activation in the heart induces dilated cardiomyopathy (DCM), whereas inhibition of endogenous Mst1 prevents apoptosis and cardiomyopathy in response to pathologically relevant stresses 14, 16 . Mst1 facilitates accumulation of protein aggresomes and p62/SQSTM1 in the heart in vivo (Fig. 2a,b and Supplementary Fig. 1e,f). This led us to hypothesize that Mst1 activation in response to stress inhibits autophagy, detrimentally affecting cardiomyocytes (CMs) and promoting heart failure. Thus, the goals in this study were 1) to examine whether Mst1 inhibits autophagy in the heart, and, if so, 2) to examine the molecular mechanism by which Mst1 regulates the autophagic machinery, and, finally, 3) to show that Mst1-induced suppression of autophagy is involved in protein aggresome accumulation and cardiac dysfunction during cardiac remodeling. Results Endogenous Mst1 promotes cardiac dysfunction through inhibition of autophagy after myocardial infarction (MI) We previously showed that endogenous Mst1 plays an essential role in mediating left ventricular (LV) dysfunction after MI 16 . Heart failure is often accompanied by accumulation of damaged proteins and organelles, in the form of aggresomes. Microscopic analyses of the chronic MI mouse heart showed that aggresomes accumulate in the perinucleus of border zone and remote area CMs (Fig. 1a). The aggresomes co-localized with p62/SQSTM1 (p62), a protein known to be degraded by autophagy, suggesting insufficient clearance of aggresomes by autophagy (Fig. 1a). The accumulation of aggresomes and p62 was markedly attenuated in transgenic mice with cardiac-specific overexpression of DN-Mst1 (Tg-DN-Mst1) and Mst1 −/− mice, suggesting that endogenous Mst1 negatively affects protein and organelle quality control in post MI hearts (Fig. 1a). Autophagy is activated in the post MI heart, as evidenced by increases in LC3-II (Fig. 1b) and accumulation of GFP-LC3 puncta in the border zone in transgenic mice harboring GFP-LC3 (Tg-GFP-LC3) (Fig. 1c). Suppression of Mst1 enhanced the indicators of autophagy in the post MI hearts, suggesting that endogenous Mst1 negatively regulates autophagy (Fig. 1b,c). In order to elucidate the role of autophagy in mediating the protection observed in Tg-DN-Mst1 mice 16 , we crossed Tg-DN-Mst1 mice with Beclin1+/− mice. The reduction in both protein aggregation and p62 accumulation observed in Tg-DN-Mst1 mice was reversed and the increase in GFP-LC3 puncta was suppressed in the Beclin1+/− -Tg-DN-Mst1 hearts, indicating suppression of autophagy (Fig. 1a – c and Supplementary Fig. 1a). Furthermore, the suppression of LV remodeling, MI scar contraction, and improved LV function and survival rate observed in Tg-DN-Mst1 mice were all reversed in the Beclin1+/− -Tg-DN-Mst1 mouse hearts (Fig. 1d,e and Supplementary Fig. 1b – d). These results suggest that autophagy plays an important role in mediating the protective effects of Mst1 suppression in the post MI heart. Mst1 promotes protein aggregate accumulation in cardiomyocytes We examined whether Mst1 activation is sufficient to induce aggresome formation. Cardiac-specific Mst1 transgenic mice (Tg-Mst1) exhibited more polyubiquitinated protein (Fig. 2a and Supplementary Fig. 1e) and stronger co-localization of vimentin and αB-crystallin in the perinucleus of CMs than non-transgenic (NTg) mice (Supplementary Fig. 1f). Co-localization of aggresomes and p62 was markedly greater in Tg-Mst1 than in NTg (Fig. 2b). Increased co-localization of aggresomes and p62 was also observed in CMs overexpressing Mst1 (Fig. 2c and Supplementary Fig. 1g), indicating a cell autonomous effect. Using transmission electron microscopy (TEM), electron-dense amorphous structures characteristically consistent with aggresomes 17 were observed in Tg-Mst1 CMs (Fig. 2d and Supplementary Fig. 1h). These results suggest that Mst1 activation is sufficient to stimulate protein aggregation. Mst1 suppressed long-lived protein degradation compared to LacZ in CMs. Conversely, transduction with adenovirus harboring DN-Mst1 (Ad-DN-Mst1) or knockdown of Mst1 by an adenovirus harboring shRNA for Mst1 (Ad-sh-Mst1) increased long-lived protein degradation under both nutrient-rich and starved conditions (Fig. 2e). We then investigated the effect of Mst1-induced aggresome accumulation upon CM survival independently of the pro-apoptotic effect of Mst1. Although the increase in cell death induced by Mst1 overexpression was suppressed by zVAD-fmk, a pan-caspase inhibitor, during the initial 48 hours of Mst1 transduction, Mst1 still induced cell death after 72 hours of transduction, accompanied by aggresome formation (Supplementary Fig 1i). Thus, Mst1 erodes protein quality control, thereby promoting cell death in CMs. Mst1 negatively regulates autophagy in cardiomyocytes Autophagosomes, observed by TEM, and GFP-LC3 puncta were significantly fewer in Tg-Mst1 than in NTg mice at baseline, and remained fewer even after starvation. Conversely, there were significantly more autophagosomes in Tg-DN-Mst1 and Mst1−/− than in NTg mice both at baseline and after starvation (Fig. 2f and Supplementary Fig. 2a,b). There was significantly less LC3-II and significantly more p62 in Tg-Mst1 than in NTg hearts. Conversely, there was significantly more LC3-II and significantly less p62 in Tg-DN-Mst1 and Mst1−/− than in NTg hearts (Fig. 2g and Supplementary Fig. 2c). These results suggest that Mst1 negatively regulates autophagy. Mst1 significantly inhibited accumulation of GFP-LC3 puncta in the presence of chloroquine (Cq, 10 mg kg−1, ip injection), an inhibitor of autophagosome-lysosome fusion 18 (Supplementary Fig. 2d). In CMs transduced with Ad-mRFP-GFP-LC3 19 , Mst1 significantly decreased the number of both green and red puncta compared to LacZ, and there was a significantly smaller increase in the number of red puncta, corresponding to autolysosomes, than yellow puncta, corresponding to autophagosomes, in merged images. Conversely, knockdown of Mst1 significantly increased the number of both green and red puncta compared to LacZ, and there was a significantly greater increase in the number of red puncta than yellow puncta in merged images (Fig. 2h and Supplementary Fig. 2e). These results suggest that Mst1 inhibits autophagic flux. Mst1 also potently inhibited both baseline and GD-induced autophagy in CMs, as evidenced by a decrease in LC3-II, an increase in p62, and a decrease in the number of GFP-LC3 puncta, whereas inhibition of endogenous Mst1 stimulated autophagy, suggesting that Mst1 suppression of autophagy is cell-autonomous (Supplementary Fig. 2f,g). WW45 downregulation moderately promoted autophagy but increased Lats2 expression did not modulate autophagy (Supplementary Fig. 2h), suggesting that components of the Hippo pathway upstream of Mst1 negatively affect autophagy through Mst1 but those downstream of Mst1 may not. GD-induced autophagy was also enhanced in Mst1−/− - and Mst1−/− Mst2−/− -MEFs compared to in WT-MEFs (Supplementary Fig. 2i,j), suggesting that Mst1 suppression of autophagy also functions in other cell types. Mst1 physically interacts with Beclin1, thereby inhibiting the Beclin1-Vps34 complex In order to elucidate how Mst1 inhibits autophagy, we investigated whether Mst1 interacts with autophagy-associated proteins, including ULK1, Atg4B, Atg5, Beclin1, Atg7, and LC3, in CMs using co-immunoprecipitation assays. Endogenous Beclin1 strongly interacted with Mst1 both in vitro and in vivo, while ULK1, a homolog of yeast Atg1, only weakly interacted with Mst1 in vitro (Fig. 3a and Supplementary Fig. 3a,b). None of the other autophagy-associated proteins interacted with Mst1. Mst1 significantly decreased Vps34 lipid kinase activity in CMs (Supplementary Fig. 3c). The activity of Atg14L-associated Vps34, reflecting complex I activity 10, 11 , was also significantly suppressed in the presence of Mst1 (Fig. 3b). The number of GFP-2xFYVE dots, indicating in situ activity of the Beclin1-Vps34 complex 20 , was also significantly decreased in the presence of Mst1, but was increased by inhibition of endogenous Mst1 (Fig. 3c), suggesting that Mst1 negatively regulates Beclin1-Vps34 complex activity. Mst1 significantly attenuated the interactions between Beclin1 and Vps34 and between Beclin1 and Atg14L (Fig. 3d), suggesting that Mst1 induces dissociation of complex I. Complex I activity is modulated by several Beclin1-interacting proteins. We evaluated whether Mst1 affects interaction between Beclin1 and Bcl-2, Bcl-xL, Rubicon, Atg14L or UVRAG using co-immunoprecipitation assays in CMs. Mst1 significantly enhanced binding of both Bcl-2 and Bcl-xL to Beclin1 but attenuated Atg14L binding to Beclin1, both in vitro and in vivo (Fig. 3e and 3f). Neither Rubicon nor UVRAG binding to Beclin1 was affected by Mst1. The binding of Beclin1 to Atg14L was significantly increased and the binding of Bcl-2/Bcl-xL to Beclin1 was markedly attenuated in Tg-DN-Mst1 and Mst1−/− mouse hearts (Fig. 3f and Supplementary Fig. 3d), suggesting that Mst1 is a physiological kinase mediating the interaction between Beclin1 and Bcl-2/Bcl-xL, molecules known to disrupt the interaction between Beclin1 and Vps34. Mst1 suppression of autophagy was abolished when Bcl-2 and Bcl-xL were downregulated (Fig. 3g and Supplementary Fig. 3e). Mst1 inhibition of autophagy was dose-dependently reversed by treatment with ABT-737 (Fig. 3h and Supplementary Fig. 3f), a BH3 mimetic 21 that significantly decreased the Mst1-induced increase in Bcl-2 binding to Beclin1 (Supplementary Fig. 3g). These results suggest that Mst1 inhibition of autophagy is mediated by interaction between Bcl-2/Bcl-xL and the BH3 domain of Beclin1. Beclin1 associates with Atg14L when autophagy is stimulated but homodimerizes when inactive 22, 23 . Co-immunoprecipitation assays showed that Mst1 stimulated association between Flag-tagged Beclin1 and HA-tagged Beclin1 (Fig. 3i), suggesting that Mst1 inhibits interaction between Beclin1 and complex I by promoting formation of the inactive Beclin1 homodimer 22–25 . Mst1 phosphorylates Beclin1 at Thr108 in the BH3 domain In vitro kinase assays showed that GST-Beclin1-WT containing full length Beclin1 and a Beclin1 fragment containing amino acids (AA) [72–163] (Beclin1-N2), but not other fragments, can be phosphorylated by Mst1 (Fig. 4a,b and Supplementary Fig. 4a). Using mass spectrometry, the threonine residue at position 108 (Thr108) in Beclin1, located in the BH3 domain and highly conserved across species, was found to be phosphorylated by Mst1 (Fig. 4c and Supplementary Fig. 4b). GST-Beclin1 Thr108Ala (T108A) was not phosphorylated by Mst1 (Supplementary Fig. 4c), suggesting that Thr108 is the major site of phosphorylation by Mst1. Immunoblot analyses with phosphorylated Thr108-specific antibody showed increased phosphorylated Beclin1 levels in the presence of Mst1, but not in the presence of DN-Mst1, in CMs in vivo and in vitro (Fig. 4d). Thr108-phosphorylated Beclin1 accumulated significantly more in the perinucleus of CMs in Tg-Mst1 mice than in NTg mice (Fig. 4e). Thr108-phosphorylated Beclin1 (Supplementary Fig. 4d) co-localized with KDEL, a marker of the endoplasmic reticulum (ER), but not with TGN46, a marker of the Golgi apparatus, or with Mitotracker®, a mitochondrial marker (Fig. 4f and Supplementary Fig. 4e) in CMs, suggesting that Mst1 phosphorylates Thr108 of Beclin1 located in the ER. Mst1-induced phosphorylation induces homodimerization of Beclin1 Interaction between GST-Beclin1-WT and Bcl-2 was enhanced when GST-Beclin1-WT was phosphorylated by Mst1 (Fig. 5a). GST-Beclin1 Thr108Asp (T108D), a phospho-mimetic mutant, interacted with both Bcl-2 and Bcl-xL to the same extent as GST-Beclin1-WT phosphorylated by Mst1, but GST-Beclin1-T108A was less able to interact with Bcl-2/Bcl-xL than GST-Beclin1-WT, even after a kinase reaction with Mst1 (Fig. 5b). Phosphorylation of GST-Beclin1-WT by Death-associated protein kinase (DAPK) decreased the interaction between GST-Beclin1-WT and Bcl-2 (Fig. 5a), as shown previously 26 , confirming the specificity of our assay. These results suggest that Mst1 directly stimulates interaction between Beclin1 and Bcl-2. Crystal structure analysis of the Beclin1-Bcl-xL complex 27 revealed that Thr108 of Beclin1 is located in the N-terminus of the BH3 domain and interacts with the α3-helix of Bcl-xL at the entrance of the hydrophobic groove (Supplementary Fig. 5a,b). As His113 of Bcl-xL is a basic AA with a positive electric charge, phosphorylation of Thr108, which confers a negative charge to Thr108, should enhance its interaction with His113. Consistent with our hypothesis, mutation of His117 of mouse Bcl-2, which corresponds to His113 of human Bcl-xL, to Ala dramatically decreased the interaction between GST-Beclin1-WT and Bcl-2, even in the presence of Mst1 (Fig. 5c). In vitro binding assays using recombinant proteins showed that Bcl-2 interacts not only with GST-Beclin1-N2, which contains the BH3 domain, but also with GST-Beclin1-MID (AA [150–284]), which contains the coiled-coil domain (CCD). Mst1 kinase activity enhanced the interaction of Bcl-2 with GST-Beclin1-N2, but not GST-Beclin1-MID (Fig. 5d). GST-Beclin1-MID could not interact with truncated Bcl-2 missing the BH4 domain, suggesting that the Beclin1 CCD binds to Bcl-2 in its BH4 domain (Fig. 5e). Beclin1 homodimerization increased dramatically when Beclin1-WT was incubated with Bcl-2-WT after a kinase reaction with Mst1, but not in the absence of either Mst1 kinase activity or Bcl-2 (Fig. 5f and Supplementary Fig. 5c). These results suggest that phosphorylation of Beclin1 by Mst1 stabilizes Beclin1 homodimerization by enhancing interaction between Beclin1 and Bcl-2 (Supplementary Fig. 5d). Mst1-induced phosphorylation of Beclin1 not only inhibits autophagy but also induces apoptosis by sequestering Bcl-2 from Bax We investigated how Thr108 phosphorylation of Beclin1 affects autophagy. Beclin1-T108D suppressed the Vps34 kinase activity in the Atg14L-Beclin1 complex and significantly decreased the number of GFP-2xFYVE dots in in situ assays in CMs, even in the absence of Mst1. Conversely, Mst1 failed to suppress the Vps34 kinase activity or reduce the number of GFP-2xFYVE dots in the presence of Beclin1-T108A (Fig. 5g,h). The number of GFP-LC3 puncta in cultured CMs was increased in the presence of Beclin1-T108A at baseline (Fig. 6a). Under starved conditions, Beclin1-T108A abolished the Mst1-induced decrease in GFP-LC3 puncta. Conversely, Beclin1-T108D decreased the number of GFP-LC3 puncta in CMs under starved conditions even in the absence of Mst1 overexpression. Similar results were obtained with immunoblot analyses (Supplementary Fig. 6a). These results suggest that Thr108 phosphorylation of Beclin1 by Mst1 negatively affects autophagy in CMs. Since Bcl-2/Bcl-xL also bind to other BH3 domain-containing proteins, including Bax, altered interaction between Beclin1 and Bcl-2/Bcl-xL may affect Bax function. Bax knockdown significantly suppressed Mst1-induced apoptosis, suggesting that Mst1 stimulates CM apoptosis through Bax (Supplementary Fig. 6b). Consistently, Mst1 not only stimulated interaction between Beclin1 and Bcl-2 but also attenuated interaction between Bcl-2 and Bax, allowing Bax to take an active conformation. Beclin1-T108D also not only enhanced the interaction between Beclin1 and Bcl-2 but also decreased the interaction between Bax and Bcl-2 and increased the amount of active Bax even in the absence of Ad-Mst1. In contrast, Beclin1-T108A neither increased the interaction between Beclin1 and Bcl-2 nor decreased the interaction between Bax and Bcl-2, such that Bax remained inactive, even in the presence of Ad-Mst1 (Fig. 6b). Beclin1-T108D significantly increased the number of TUNEL-positive CMs and the amount of cleaved caspase-3, even in the absence of Ad-Mst1, whereas Beclin1-T108A suppressed the Mst1-induced increases in TUNEL-positive CMs and cleaved caspase-3 (Fig. 6c). Thus, an Mst1-induced increase in the interaction of Beclin1 with Bcl-2 family proteins not only inhibits autophagy but also enhances apoptosis through dissociation of Bcl-2 from Bax in CMs (Supplementary Fig. 6c). Mst1 inhibited GD-induced autophagy and increased accumulation of aggresomes in Bax−/−Bak−/− -MEFs, as well as in WT-MEFs (Supplementary Fig 6d – f). Although knockdown of endogenous Bax and Bak significantly reduced Mst1-induced cell death during the initial 48 hours, Mst1 still decreased survival after 72 hours of Ad-Mst1 transduction compared to in Ad-LacZ-treated Bax−/−Bak−/− -MEFs (Supplementary Fig 6g). These results suggest that Mst1 promotes cell death independently of the Bax/Bak-mediated pathway by inhibiting autophagic activity and promoting protein aggregate accumulation. Conversely, Atg7−/− MEFs with overexpressed Mst1 did not show additional perinuclear accumulation of aggresomes compared to Ad-LacZ-treated Atg7−/− -MEFs (Supplementary Fig. 6h,i), suggesting that Atg7 downregulation and Mst1 impair protein quality control through a common mechanism. Mst1 transduction into Atg7−/− -MEFs reduced survival after 48 and 72 hours compared to LacZ transduction, suggesting that the pro-apoptotic effect of Mst1 can kill MEFs independently of suppression of autophagy (Supplementary Fig. 6j). Endogenous Mst1 plays an essential role in mediating phosphorylation of Beclin1 in the failing heart We investigated whether Thr108 of Beclin1 is phosphorylated in the post MI heart. Six weeks after MI surgery, the Thr108-phosphorylated Beclin1 level was significantly elevated in NTg hearts but not in Tg-DN-Mst1 or Mst1−/− hearts, suggesting that endogenous Mst1 phosphorylates Beclin1 in CMs in the post MI heart (Fig. 6d,e). We here demonstrate that increased activation of Mst1 inhibits autophagy below the physiological level by promoting Beclin1-Bcl-2 interaction, thereby inducing chronic heart failure. On the other hand, we have also shown that excessive activation of autophagy beyond a physiological range causes cell death, thereby aggravating cardiac function 4 . Beclin1 is strongly upregulated by I/R 4 , but the protein level of Beclin1 gradually decreases in the chronic phase of MI. As the amount of endogenous Mst1 molecules is limited, even though the activity of Mst1 is upregulated during stress conditions (Supplementary Fig. 6k) 14 , strong upregulation of Beclin1 should increase the amount of unphosphorylated Beclin1, as appears to be the case in I/R (Supplementary Fig. 6l), as well as subsequent activation of the Vps34 complex. In fact, experiments show that Beclin1 overexpression does alleviate Mst1-induced suppression of autophagy in CMs (Supplementary Fig. 6m). Thus, we propose that the extent of autophagy in the heart may be modulated by the balance between Mst1 activation and Beclin1 expression. Finally, we investigated whether the Mst1-Beclin1 interaction-mediated detrimental effect is also present in human failing hearts. Mst1 activity and the amount of Thr108-phosphorylated Beclin1 were significantly higher in failing hearts from individuals with end-stage DCM who received heart transplants than in hearts from donors with normal cardiac function (Fig. 6f and Supplementary Table 1). The amount of p62 was also significantly higher and the LC3-II amount was significantly lower in the failing hearts than in the normal hearts (Fig. 6f), suggesting that autophagy is suppressed in the failing human heart. Staining of myocardial sections showed more prominent co-localization of aggresomes with p62 in the perinucleus of CMs in the failing hearts than in normal hearts (Fig. 6g). Discussion A variety of disorders, collectively termed proteinopathies, are characterized by intracellular deposition of aggresomes, including neurodegenerative disorders, liver insufficiencies and heart failure caused by volume and pressure overload 28, 29 . Abnormalities in the protein degradation mechanisms, namely, the ubiquitin proteasome system and autophagy, can cause proteinopathies, but how they are regulated by the stress-signaling pathway is poorly understood. We here demonstrate that Mst1, a pro-apoptotic kinase, facilitates proteinopathy in a chronic MI model by directly inhibiting autophagy through phosphorylation of Beclin1, a key regulator of autophagosome formation. Mst1-induced phosphorylation of Beclin1 induces interdependent modulation of Beclin1, Bcl-2/Bcl-xL and Bax, thereby regulating autophagy and apoptosis simultaneously. Furthermore, Mst1 activation, Beclin1 phosphorylation, attenuation of autophagy and protein aggregate accumulation are all exacerbated in human end-stage DCM hearts. Thus, Mst1 may be an important target for treatment in heart failure patients. Beclin1 physically interacts with the Bcl-2 family proteins, and their interaction can be modulated by phosphorylation, including phosphorylation of Beclin1 in the BH3 domain by DAPK and Bcl-2 in its nonstructural loop by JNK1, thereby promoting dissociation of Beclin1 from Bcl-2, which, in turn, induces autophagy 26, 30, 31 . Basal interaction between Beclin1 and the Bcl-2/Bcl-xL is prerequisite for these mechanisms to be able to activate autophagy. However, the binding affinity of Bcl-2/Bcl-xL to Beclin1 is low except in the case of Bcl-2 encoded by Kaposi’s sarcoma-associated herpesvirus 11, 23, 24 . Then how can the basal interaction between Beclin1 and Bcl-2/Bcl-xL take place? We here demonstrate that Mst1-induced phosphorylation of Beclin1 in its BH3 domain at Thr108 promotes binding of Beclin1 with Bcl-2/Bcl-xL. Since interaction between Beclin1 and Bcl-2/Bcl-xL is markedly reduced when Mst1 activity is inhibited, Mst1 is likely to be a physiological kinase mediating the basal interaction between Beclin1 and Bcl-2/Bcl-xL. The Beclin1 CCD acts as a central interaction platform for either homodimerization in its inactive form or heterodimerization with Atg14L to stimulate autophagy. Crystallographic analyses showed that the CCDs of two Beclin1 molecules can associate with each other in an antiparallel orientation, forming a metastable structure that readily transits into a stable heterodimer complex with the CCD of Atg14L 22 . A previous study and our experiments demonstrate that not only does the Beclin1 BH3 domain interact with the Bcl-2/Bcl-xL hydrophobic groove, but the Beclin1 CCD interacts with the Bcl-2/Bcl-xL BH4 domain as well 32 . Thus, Beclin1 interacts with Bcl-2 at two sites, and the interaction at one of them is regulated by Mst1. This should allow Bcl-2 to bridge two Beclin1 molecules in an Mst1-sensitive manner, with the Beclin1 dimer further stabilized by alignment of the CCDs in an anti-parallel orientation 22, 32 . Since Beclin1-Atg14L interaction is significantly enhanced by inhibition of endogenous Mst1 in vivo, Mst1-induced phosphorylation of Beclin1 and consequent stabilization of the Beclin1 homodimer may cause dissociation of Atg14L from Beclin1, thereby diminishing the activity of Vps34 in the Ag14L-Vps34 complex. In this study, we found that Mst1 facilitates the molecular link between Beclin1 and Bcl-2, thereby not only negatively regulating autophagy, but also positively regulating apoptosis by promoting sequestration of the Bcl-2 family proteins from Bax. Suppression of autophagy exacerbates protein aggregation while stimulation of apoptosis directly leads to decreased cardiac contractility in the failing heart. Thus, inhibition of Mst1 may effectively alleviate these problems in heart failure patients. The Hippo pathway has recently emerged as a tumor suppressor signaling pathway 33 . Dual regulation of autophagy and apoptosis may enhance the function of Mst1 as a tumor suppressor by eliminating an adaptive mechanism for survival in a hypoxic environment and promoting cell death. In summary, enhancement of Beclin1-Bcl-2 interaction through phosphorylation of Beclin1 in its BH3 domain at Thr108 by Mst1 inhibits autophagy and induces apoptosis, which, when autophagic activity falls below the required level, impairs protein quality control and induces cardiac dysfunction (Supplementary Fig. 7). Online Methods Genetically modified mice Heterozygous GFP-LC3 transgenic (Tg-GFP-LC3) mice (C57BL/6J background, strain GFP-LC3#53, RIKEN BioResource Center) containing a rat LC3-EGFP fusion under control of the chicken β-actin promoter, homozygous Mst1 knock-out (Mst1−/−) mice (C57BL/6J background), heterozygous Beclin1 knock-out (Beclin1+/−) mice (C57BL/6J background), and transgenic mice with cardiac-specific overexpression of Mst1 (Tg-Mst1) and DN-Mst1 (Tg-DN-Mst1, C57BL/6J background) 14 were bred in-house. We used age-matched male mice in all animal experiments. All animal protocols were approved by the Institutional Animal Care and Use Committee of the University of Medicine and Dentistry of New Jersey. Human samples from explanted hearts The samples from explanted hearts used in this study were obtained from 6 patients who had received heart transplants and 6 age-matched donors (listed in the Supplementary Table) at the Taipei Veterans General Hospital. The study was approved by the institutional Ethics Committee (VGHIRB No.:2012-06-028D), and all patients or their family expressed their willingness to participate through an informed consent form. Myocardial posterior wall samples were collected during preparation of donor hearts for transplantation in the hospital. Myocardial samples from near the mitral annulus were obtained from recipients at the time of therapeutic transplantation. Immediately after tissue procurement, the samples for biochemical study were stored in liquid nitrogen and kept at −80°C. Selected samples for immunohistochemical analysis were fixed in 4% paraformaldehyde in phosphate-buffered saline (pH 7.4), paraffin-embedded and sectioned. Primary culture of neonatal rat ventricular CMs Primary cultures of ventricular CMs were prepared from 1-day-old Crl: (WI) BR-Wistar rats (Harlan Laboratories, Somerville, NJ, USA) as described previously 34 . A CM-rich fraction was obtained by centrifugation through a discontinuous Percoll gradient. Mouse embryonic fibroblasts (MEFs) Bax−/−Bak−/− MEFs were kindly provided by Richard N. Kitsis (Albert Einstein University, Bronx, NY). MEFs deficient in Mst1 were harvested from Mst1−/− mice. To make Mst1−/−Mst2−/− MEFs, MEFs were harvested from Mst1−/−Mst2flox/flox mice and then stably transfected with MCMV-neo-Cre. Atg7−/− MEFs were harvested from Atg7flox/flox mice provided by Dr. Masaaki Komatsu (Tokyo Metropolitan Institute of Medical Science, Tokyo, Japan) and stably transfected with MCMV-neo-Cre. MEF cells were cultured at 37°C and 5% CO2 in DMEM supplemented with 10% fetal bovine serum. Antibodies and reagents The following commercial antibodies were used: phospho-Mst1 [Thr183](#ab79199, 1:1,000 for WB), TGN46 (2F7.1, #ab2809, 1:100 for IHC) and Vimentin (#ab71144, 1:100 for IHC)(abcam); Mst1 (7/MST1, #611052, 1:1,000 for WB), Bcl-2 (#554087, 1:1,000 for WB) and Bcl-xL (#610747, 1:1,000 for WB)(BD Bioscience); Cleaved caspase-3 (D3E9, #9579, 1:1,000 for WB), Cytochrome c (#4272, 1:1,000 for WB), DYKDDDDK (Flag)-tag (#2368, 1:2,000 for WB), HA-tag (C29F4, #3724, 1:2,000 for WB), Histone H3 (#9717, 1:1,000 for WB), Myc-tag (conjugated to magnetic beads)(9B11, #5698), Sav1 (WW45)(#3507, 1:1,000 for WB), ULK1 (D8H5, #8054, 1:1,000 for WB), UVRAG (#5320, 1:1,000 for WB), Vps34 (D9A5, #4263, 1:1,000 for WB) and secondary antibodies (Anti-mouse/rabbit IgG) conjugated with horseradish peroxidase (Cell Signaling); Secondary antibodies (Anti-mouse/rabbit IgG) conjugated with Alexa Fluor® 488, Alexa Fluor® 555 or Alexa Fluor® 647 (Life Technologies); Bax (6A7, #AM44, 1:1,000 for WB)(Merck-Millipore); Atg4B (9H5, #M134-3, 1:1,000 for WB), Atg5 (#PM050, 1:1,000 for WB), Atg7 (#PM039, 1:1,000 for WB), LC3 (8E10, #M186-3, 1:1,000 for WB), Atg14L (#PD026, 1:1,000 for WB) and Rubicon (#PD027, 1:1,000 for WB)(MBL); p62/SQSTM1 (TA307334, 1:1,000 for WB; 1:100 for IHC) and Mst2 (STK3, EP1466Y, #TA300843, 1:1,000 for WB)(Origene Technologies); Troponin T (Ab-1, #MS-295-P, 1:500 for IHC)(Thermo Scientific); α-actinin (H-300, #sc-15335, 1:2,000 for WB), Bax (P-19, #sc-526, 1:1,000 for WB), Bak (G-23, #sc-832, 1:1,000 for WB), Beclin1 (H-300, #sc-11427, 1:1,000 for WB), Troponin I (H-170, #sc-15368, 1:200 for IHC) and poly-ubiquitin (P4D1, #sc-8017, 1:1,000 for WB; 1:100 for IHC)(Santa Cruz); GAPDH (#G9545, 1:2,000 for WB), tubulin (DM1A, #T9026; 1:2,000 for WB), HA-tag (conjugated to agarose beads)(HA-7, #A2095), Flag-tag (conjugated to agarose beads)(FLAG-M2, #A2220), ULK1 (#A7481, 1:1,000 for WB) and mouse control IgG (Sigma Aldrich); and KDEL (10C3, #ADI-SPA-827, 1:2,000 for WB; 1:100 for IHC) and CryAB (ADI-SPA-224, 1:100 for IHC)(ENZO). For detection of phosphorylation of Beclin1 at Thr108, a rabbit polyclonal phosphorylation-specific antibody was raised against a synthetic peptide of the BH3 domain of human Beclin1, EASDGG{T-p}MENLSRR (1:500 for WB; 1:50 for IHC). Mouse monoclonal antibody against Lats2 has been described (1:1,000 for WB; 1:100 for IHC) 35 . Alexa Fluor® 555 phalloidin and Alexa Fluor® 647 MitoTracker® Deep Red FM were purchased from Life Technologies. Chloroquine diphosphate was purchased from Fluka Biochemika. ABT-737 was purchased from Selleck Chemicals. Immunoblotting Cardiomyocytes were lysed with RIPA buffer. Lysates were centrifuged at 13,200 rpm for 15 min at 4°C. Electrophoresis was performed on Laemmli-SDS-polyacrylamide gels. Separated proteins were transferred from the gels to PVDF membranes by semi-dry electrotransfer and immunoblotting was performed as previously described 36 . Native PAGE Recombinant Beclin1 was dissolved in a buffer containing 50 mM Tris-HCl buffer (pH 7.4), 1 mM EDTA and 150 mM NaCl at a concentration of 1 µg/mL at 4 °C. Beclin1 protein was incubated with Bcl-2 protein after kinase reaction with or without Mst1 and the proteins were crosslinked by UV in the presence of sulfo-NHS-SS-diazirine. The protein samples were mixed with an electrophoretic sample buffer (40% v/v glycerol containing 0.01% bromophenol blue) and separated on a 7.5% polyacrylamide gel in a 90 mM Tris-borate buffer system and 1 mM EDTA (pH 8.0) at 200 V for 2 h. The protein bands were visualized using 0.25% (w/v) Coomassie Brilliant Blue R-250. Fractionation Endoplasmic reticulum fractionation was performed with the ER enrichment kit from IMGENEX. After suspension in 1.5 mL of 1x isosmotic homogenization buffer, the cultured cardiomyocytes were homogenized and centrifuged for 10 min at 1,000 x g at 4°C. The supernatant was transferred into a new tube and centrifuged for 15 min at 12,000 x g at 4°C to eliminate the mitochondria and the cell debris. The resulting supernatant was ultracentrifuged at 90,000 x g for 1 h at 4°C. The pellet containing the ER was resuspended in 1x suspension buffer containing protease inhibitors. Mitochondrial and cytosolic fractions were collected as described previously 37 . Briefly, cultured cardiomyocytes were resuspended in hypotonic lysis buffer (10 mM K-HEPES (pH 7.9), 1.5 mM MgCl2, 10 mM KCl, 0.2 mM Na3VO4, 1 mM DTT, 1% Protease Inhibitor Cocktail) and homogenized. Whole cell lysates were centrifuged at 60 x g for 5 min. The supernatant was collected, and the homogenization and centrifugation was repeated on the pellet. The total homogenate was centrifuged at 1,200 x g to separate the pellet from cell membrane and cytosolic proteins. The supernatant of the total homogenate was centrifuged at 3,500 x g for 20 min to separate mitochondrial fractions. To separate cytosolic fractions, the supernatant was further centrifuged at 100,000 x g for 60 min. Immunoprecipitation CMs were lysed with IGEPAL CA-630 buffer (50 mM Tris-HCl (pH 7.4), 1% IGEPAL CA-630, 10 mM EDTA, 150 mM NaCl, 50 mM NaF, 1 µM leupeptin and 0.1 µM aprotinin). Primary antibody was covalently immobilized on protein A/G agarose using the Pierce® Crosslink Immunoprecipitation Kit according to the manufacturer's instructions (Thermo Scientific). Samples were incubated with immobilized antibody beads for at least 2 h at 4°C. After IP, the samples were washed with TBS five times. They were then eluted with glycine-HCl (0.1 M, pH 3.5) and the immunoprecipitates were subjected to immunoblotting using specific primary antibodies and conformation-specific secondary antibody that recognizes only the native IgG (Cell Signaling). Recombinant proteins In order to generate GST-Mst1, GST-Beclin1, GST-Bcl-2, and GST-Bcl-xL (full-length and fragment, wild-type and mutant), we used the pCold-GST vector (courtesy of C. Kojima, Nara Institute of Science and Technology, Ikoma, Nara, Japan) 38 . Proteins fused to glutathione S-transferase (GST) were expressed in E. coli strain BL21 (DE3) cultured in LB medium containing 100 µg/mL ampicillin. Protein expression was induced by addition of 1 mM IPTG after lowering the temperature from 37°C to 15°C. Cells were cultured for 16 h following induction and purified with glutathione Sepharose 4B (GE Healthscience). In order to remove the N-terminal GST tag, the recombinant protein immobilized on glutathione Sepharose 4B was digested at 4°C with GST-tagged human rhinovirus (HRV) 3C protease (PreScission protease, GE Healthcare). Pull-down binding assays A GST-tagged fusion protein was digested to remove the GST tag, then mixed with 500 µL of PBS containing 0.5% Triton X-100 and incubated for 30 min at 4°C. A slurry of glutathione Sepharose 4B in which a second GST-tagged fusion protein was immobilized was added, followed by further incubation for 30 min at 4°C. After washing three times with phosphate-buffered saline, proteins were eluted with 2x SDS sample buffer. The eluates were subjected to SDS-PAGE and proteins were detected by immunoblot. In vitro kinase assays In vitro kinase assays were carried out as described with modifications 36 . Recombinant active Mst1 (10 ng) (Millipore) was incubated with full-length or fragmented Beclin1 (1 µg) in a kinase buffer (50 mM HEPES (pH 7.4), 15 mM MgCl2 and 200 µM sodium vanadate containing 100 µM ATP or 5 µM ATP and 10 µCi [γ-32P] ATP per reaction) at 30°C for 30 min. Phosphorylated proteins were separated by SDS-PAGE and analyzed by autoradiography. Construction of adenoviruses Recombinant adenovirus vectors were constructed, propagated and titered as previously described 34 . Briefly, pBHGloxΔE1,3 Cre (Microbix), including the ΔE1 adenoviral genome, was co-transfected with the pDC316 shuttle vector containing the gene of interest into HEK293 cells using LipofectAMINE 2000 (Life Technologies). Through homologous recombination, the test genes were integrated into the E1-deleted adenoviral genome. The viruses were propagated in HEK293 cells. We made replication-defective human adenovirus type 5 (devoid of E1) harboring 3xFlag-Mst1-WT, 3xFlag-Beclin1-WT, Beclin1-T108A mutant, Beclin1-T108D mutant, 3xFlag-Vps34-WT, Atg14-WT-2xHA, myc-Bcl-2-WT and GFP-2xFYVE. The mutant Beclin1 plasmids were generated by site-directed mutagenesis. All mutations were verified by sequencing. The generation of adenoviruses harboring Mst1-WT, DN-Mst1 [K59R], Beclin1-WT, JNK1, GFP-LC3 and mRFP-GFP-LC3 has been described 4, 14, 19 . Adenovirus harboring β-galactosidase (Ad-LacZ) was used as a control. Construction of short hairpin RNA (shRNA) adenoviral expression vectors The pSilencer 1.0-U6 expression vector was purchased from Ambion. The U6 RNA polymerase III promoter and the polylinker region were subcloned into the adenoviral shuttle vector pDC311 (Microbix). The Mst1 shRNA targeting sequence was: 5’-AGACCGTGCAACTGAGGAAC-3’. The Bcl-2 shRNA targeting sequence was: 5’-GGGAGAACAGGGTATGATA-3’. The Bcl-xL shRNA targeting sequence was: 5’-GGAGATGCAGGTATTGGTG-3’. The Bax shRNA targeting sequence was: 5’-CTCCGGCGAATTGGAGATGAA-3’. Recombinant adenoviruses were generated by homologous recombination in HEK293 cells as described above. Lipid kinase assay Ad-3xFlag-Vps34, Ad-Beclin1-WT, Ad-Beclin1-T108A or Ad-Beclin1-T108D, and Ad-Mst1 or Ad-LacZ were co-transduced into CMs. Cells were lysed in lysis buffer (1% IGEPAL CA-630, 20 mM Tris-HCl (pH 7.5), 137 mM NaCl, 1 mM MgC12, 1 mM CaC12, 100 mM NaF, 10 mM sodium pyrophosphate, 100 µM Na3VO4, 10% glycerol, 0.35 mg/mL PMSF, and protease and phosphatase inhibitor cocktails). After immunoprecipitation, beads (associated with complexed proteins) were washed three times in lysis buffer, followed by three washes in a washing buffer (100 mM Tris-HCl (pH 7.4) and 500 mM LiCl) and two washes in a reaction buffer (10 mM Tris-HCl (pH 7.4), 100 mM NaCl and 1 mM EDTA). Beads were resuspended in 60 µL of reaction buffer and 10 µL of 100 mM MnCl2 and sonicated, followed by the addition of 10 µL of 2 µg/µL phosphatidylinositol. The reaction was started by the addition of ATP (10 µL of 440 µM ATP containing [γ-32P] ATP (10 µCi)), and beads were incubated for 10 min at room temperature. The reaction was terminated by adding 20 µL of 8 M HCl, and the organic phase was extracted with 160 µL chloroform:methanol (1:1). Extracted phospholipid products were resolved by thin-layer chromatography (TLC) using a coated silica gel and a solvent composed of chloroform: methanol: H2O: NH4OH (v/v/v/v, 9:7:1.7:0.3). Phosphorylated radioactive phosphatidylinositol 3-phosphate (PtdIns(3,4,5)P3), a reaction product separated by TLC, was visualized by autoradiography. The radioactive PtdIns(3,4,5)P3 was then excised from the thin layer plates and assayed in a liquid scintillation β-counter (LSC). Long-lived protein degradation assay Neonatal rat CMs plated in 12-well plates were transduced with Ad-LacZ, Ad-Mst1, Ad-DN-Mst1 or Ad-sh-Mst1. After 48 h, intracellular proteins were labeled for 18 h at 37°C with 3H-l-valine (1 µCi/mL) in DMEM. After being pulse-labeled for 24 h, cells were washed three times and cultured in DMEM supplemented with excess unlabeled valine (10 mM) for 16 h to chase out short-lived proteins. Cells were then washed and further cultured for 4 h in complete medium or Earle balanced salt solution (EBSS) containing unlabeled valine (10 mM). Both media and cell lysates were subjected to trichloroacetic acid (TCA) precipitation. Long-lived protein degradation was calculated as the ratio of TCA-soluble medium to TCA-precipitated cell lysate radioactivity. Mass spectrometry Two peptides containing partial human Beclin1 amino acid sequences were prepared as follows: NT1 peptide (88–100 AA of Beclin1: MMSTESANSFTLI) and NT2 peptide (102–121 AA of Beclin1: EASDGGTMENLSRRLKVTGD). After a kinase reaction with Mst1, the samples were analyzed on a 4700 Proteomics Analyzer tandem mass spectrometer (Life Technologies). Positive ion mass spectra were acquired in the reflectron mode. Tandem mass spectra of selected ions were acquired using a method optimized with 1 kV collision energy. Data analysis was performed with Data Explorer software (Life Technologies). Immunohistochemistry Neonatal CMs were cultured on coverslips, transduced with adenoviruses and fixed in 4% paraformaldehyde. Mouse hearts were fixed with 4% paraformaldehyde by perfusion and sectioned at 10 µm thickness. De-paraffinized tissue sections were antigen unmasked using citrate buffer. Samples were permeabilized with PBST (0.3% Triton X-100 in PBS), and nonspecific binding was blocked with 5% goat serum in PBST for 90 min. For immunofluorescent staining, an overnight incubation with specific antibodies was followed by 2 h of incubation with Alexa Fluor® 488, 555, 594 or 647 Dye-conjugated secondary antibody (Life Technologies). Samples were washed and mounted on glass slides with a reagent containing 4′, 6-diamino-2-phenilindole (DAPI) (VECTASHIELD; Vector Laboratories). Cells were observed under a fluorescence microscope (Eclipse E800, Nikon) or with a laser-scanning confocal image system (A1, Nikon). Fluorescence microscopic detection of GFP-LC3 or mRFP-GFP-LC3 CMs grown on gelatinized coverslips were transduced with Ad-GFP-LC3 or Ad-mRFP-GFP-LC3. After 48 h, media were changed to complete, glucose-free or amino acid-free medium, with or without chloroquine. Tissue samples for GFP observation were fixed with 4% paraformaldehyde in PBS. The fixed tissues were treated with 15% sucrose in PBS for 4 h and then with 30% sucrose solution overnight. Tissue samples were embedded in Tissue-Tek OCT compound (Sakura Finetechnical Co.Ltd) and stored at −70°C. The samples were sectioned at 5–7 µm thickness with a cryostat (CM3050 S, Leica), air-dried for 30 min, and stored at −20°C. The fluorescence of GFP-LC3 or mRFP-GFP-LC3 was observed under a fluorescence microscope as previously described 19, 39 . The number of GFP-LC3 or mRFP-GFP-LC3 puncta was counted in five independent visual fields. Detection of aggresomes The ProteoStat® Aggresome Detection Kit and anti-fade mounting medium were purchased from Enzo Life Sciences. The ProteoStat® aggresome detection reagent is a 488 nm excitable red fluorescent molecular rotor that binds selectively to protein cargo within aggresomes in cells. All components of the ProteoStat® Aggresome Detection Kit were prepared according to the manufacturer's instructions 40 . One mM stock solutions of the dyes were prepared in DMSO. Phosphatidylinositol 3-kinase (PI3K) assay in situ To measure the abundance of membrane-associated phosphatidyl inositol-3-phosphate in order to evaluate the activity of the Beclin1/Vps34 complex in situ, we generated Ad-GFP-2xFYVE, which harbors the FYVE (Fab1, YOTB, Vac1p and EEA1) domain. The amino acid sequence we used for this adenovirus construction was as follows: NH2-WVPDSQAPNCMKCEARFTFTKRRHHCRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVL-COOH. This assay was performed as detailed previously 41, 42 . CMs grown on gelatinized coverslips were transduced with Ad-Mst1, Ad-DN-Mst1, Ad-sh-Mst1, Ad-LacZ, Ad-Beclin1-WT, Ad-Beclin1-T108A or Ad-Beclin1-T108D 24 h after Ad-GFP-2xFYVE transduction. After 48 h, media were changed to complete or glucose-free medium, and cells were treated with or without 3-MA (5 mM) for 2 h. Cells were fixed with 4% paraformaldehyde in PBS for 15 min. The number of GFP-2xFYVE dots in cytoplasm was counted in five independent visual fields. Electron microscopy Heart tissue was removed from the animal and quickly rinsed in PBS. The tissue was placed in a petri dish with 0.5% gluteraldehyde and 0.2% tannic acid in PBS and diced into 2 mm cubes, then transferred to modified Karnovsky's fixative (4% formaldehyde and 2.5% gluteraldehyde containing 8 mM CaCl2 in 0.1 M sodium cacodylate buffer (pH 7.4)). Samples were washed with PBS and post-fixed in 1% osmium tetroxide in 0.1 M sodium cacodylate buffer (pH 7.4) for 1 h to produce osmium black. Samples were then dehydrated through a graded series of ethanol and embedded in Epon/SPURR resin (EM Science) that was polymerized at 65°C overnight. Sections of both heart tissues and yeast cells were prepared with a diamond knife on a Reichert-Jung Ultracut-E ultra-microtome and stained with UrAc (20 min) followed by 0.2% lead citrate (2.5 min). Images were photographed with a Jeol JEM-1200EX electron microscope. MI Surgery Transgenic and nontransgenic male mice, 3 to 4 months old, were used in this study. The mice were anesthetized by intraperitoneal injection of pentobarbital sodium (60 mg/kg), and were ventilated via tracheal intubations connected to a rodent ventilator during the surgical procedure. A left thoracotomy was performed through the third intercostal space, and the left anterior descending branch of the coronary artery was visualized. Under direct microscopic control, an 8-0 nylon suture was placed around the vessel and ligated ~1.0 to 2.0 mm from the tip of the normally positioned left auricle. The chest wall was then closed in layers using 5-0 nylon sutures. Additional age-matched sham-operated control animals underwent a similar surgery without ligation of the artery. The mice were extubated and allowed to recover in a cage with the temperature maintained at 37°C overnight. Echocardiography Echocardiography was performed as described previously 14 with a 13-MHz linear ultrasound transducer. Two-dimensional guided M-mode measurements of LV internal diameter were obtained from at least three beats and then averaged. LV end-diastolic dimension (LVEDD) was measured at the time of the apparent maximal LV diastolic dimension, and LV end-systolic dimension (LVESD) was measured at the time of the most anterior systolic excursion of the posterior wall. LVEF was calculated using the following formula: LVEF (%)=100 x (LVEDD 3 - LVESD 3 ) / LVEDD 3 . Assessment of LV scar size after chronic MI Hearts were fixed in 10% formalin, cut into 4 transverse slices and subjected to Masson’s Trichrome staining for measurement of the LV scar after chronic MI. The average infarct size was obtained by calculation of the average length of the circumference in the infarct portion and the normal area from consecutive myocardial slices as shown in Supplementary Figure 1c. TUNEL staining in cultured cardiomyocytes Cardiomyocytes were fixed in PBS containing 4% paraformaldehyde. Staining was performed using the In Situ Cell Death Detection kit (Roche) as described 43 . Viability of the cells Viability of the cells was measured by Cell Titer Blue assays (Promega) as previously described 43 . Statistics Statistical analyses between groups were done by unpaired Student’s t test or one-way ANOVA followed by a post hoc Fisher’s comparison test. A value of less than 0.05 was considered significant. Survival curves were analyzed by Kaplan-Meier-Log-rank (Mentel-Cox) test. Statistical analyses were done using GraphPad Prism (GraphPad Software, Inc.). Supplementary Material 1

          Related collections

          Most cited references 26

          • Record: found
          • Abstract: found
          • Article: not found

          Exercise-induced BCL2-regulated autophagy is required for muscle glucose homeostasis.

          Exercise has beneficial effects on human health, including protection against metabolic disorders such as diabetes. However, the cellular mechanisms underlying these effects are incompletely understood. The lysosomal degradation pathway, autophagy, is an intracellular recycling system that functions during basal conditions in organelle and protein quality control. During stress, increased levels of autophagy permit cells to adapt to changing nutritional and energy demands through protein catabolism. Moreover, in animal models, autophagy protects against diseases such as cancer, neurodegenerative disorders, infections, inflammatory diseases, ageing and insulin resistance. Here we show that acute exercise induces autophagy in skeletal and cardiac muscle of fed mice. To investigate the role of exercise-mediated autophagy in vivo, we generated mutant mice that show normal levels of basal autophagy but are deficient in stimulus (exercise- or starvation)-induced autophagy. These mice (termed BCL2 AAA mice) contain knock-in mutations in BCL2 phosphorylation sites (Thr69Ala, Ser70Ala and Ser84Ala) that prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation. BCL2 AAA mice show decreased endurance and altered glucose metabolism during acute exercise, as well as impaired chronic exercise-mediated protection against high-fat-diet-induced glucose intolerance. Thus, exercise induces autophagy, BCL2 is a crucial regulator of exercise- (and starvation)-induced autophagy in vivo, and autophagy induction may contribute to the beneficial metabolic effects of exercise.
            • Record: found
            • Abstract: found
            • Article: not found

            Distinct regulation of autophagic activity by Atg14L and Rubicon associated with Beclin 1-phosphatidylinositol-3-kinase complex.

            Beclin 1, a mammalian autophagy protein that has been implicated in development, tumour suppression, neurodegeneration and cell death, exists in a complex with Vps34, the class III phosphatidylinositol-3-kinase (PI(3)K) that mediates multiple vesicle-trafficking processes including endocytosis and autophagy. However, the precise role of the Beclin 1-Vps34 complex in autophagy regulation remains to be elucidated. Combining mouse genetics and biochemistry, we have identified a large in vivo Beclin 1 complex containing the known proteins Vps34, p150/Vps15 and UVRAG, as well as two newly identified proteins, Atg14L (yeast Atg14-like) and Rubicon (RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein). Characterization of the new proteins revealed that Atg14L enhances Vps34 lipid kinase activity and upregulates autophagy, whereas Rubicon reduces Vps34 activity and downregulates autophagy. We show that Beclin 1 and Atg14L synergistically promote the formation of double-membraned organelles that are associated with Atg5 and Atg12, whereas forced expression of Rubicon results in aberrant late endosomal/lysosomal structures and impaired autophagosome maturation. We hypothesize that by forming distinct protein complexes, Beclin 1 and its binding proteins orchestrate the precise function of the class III PI(3)K in regulating autophagy at multiple steps.
              • Record: found
              • Abstract: found
              • Article: not found

              The Beclin 1-VPS34 complex--at the crossroads of autophagy and beyond.

              An increasing body of research on autophagy provides overwhelming evidence for its connection to diverse biological functions and human diseases. Beclin 1, the first mammalian autophagy protein to be described, appears to act as a nexus point between autophagy, endosomal, and perhaps also cell death pathways. Beclin 1 performs these roles as part of a core complex that contains vacuolar sorting protein 34 (VPS34), a class III phosphatidylinositol-3 kinase. The precise mechanism of Beclin 1-mediated regulation of these cellular functions is unclear, but substantial progress has recently been made in identifying new players and their functions in Beclin 1-VSP34 complexes. Here we review emerging studies that are beginning to unveil the physiological functions of Beclin 1-VPS34 in the central control of autophagic activity and other trafficking events through the formation of distinct Beclin 1-VPS34 protein complexes. (c) 2010 Elsevier Ltd. All rights reserved.

                Author and article information

                Nat Med
                Nat. Med.
                Nature medicine
                5 September 2013
                20 October 2013
                November 2013
                01 May 2014
                : 19
                : 11
                [1 ]Cardiovascular Research Institute, Department of Cell Biology and Molecular Medicine, Rutgers, The State University of New Jersey, New Jersey Medical School, Newark, NJ 07103
                [2 ]Center for Advanced Proteomics Research and Department of Biochemistry and Molecular Biology, Rutgers, The State University of New Jersey, New Jersey Medical School, Newark, NJ 07103
                [3 ]Division of Cardiovascular Surgery, Department of Surgery, Taipei Veterans General Hospital, National Yang-Ming University School of Medicine, Taipei, Taiwan, Republic of China
                [4 ]Department of Cardiovascular Medicine, Tokyo Medical and Dental University, Tokyo, 113-8519, Japan
                [5 ]Creative Research Center of Cell Division and Differentiation, Department of Biological Sciences, KAIST, Daejeon, 305-701, Republic of Korea
                Author notes
                [6 ]Address correspondence to: Junichi Sadoshima MD PhD, Cardiovascular Research Institute, Department of Cell Biology and Molecular Medicine, Rutgers, The State University of New Jersey, New Jersey Medical School, 185 South Orange Ave, MSB G-609, Newark, NJ 07103, sadoshju@ , Phone (973) 972-8619, Fax (973) 972-8919

                Users may view, print, copy, download and text and data- mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use:

                Funded by: National Heart, Lung, and Blood Institute : NHLBI
                Award ID: R01 HL112330 || HL
                Funded by: National Heart, Lung, and Blood Institute : NHLBI
                Award ID: R01 HL102738 || HL
                Funded by: National Heart, Lung, and Blood Institute : NHLBI
                Award ID: R01 HL091469 || HL
                Funded by: National Heart, Lung, and Blood Institute : NHLBI
                Award ID: R01 HL067724 || HL
                Funded by: National Institute on Aging : NIA
                Award ID: R01 AG023039 || AG



                Comment on this article